missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ring finger protein 138 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 792.00 €
Specifications
| Antigen | Ring finger protein 138 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18441671
|
Novus Biologicals
NBP1-86987-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18491821
|
Novus Biologicals
NBP1-86987 |
0.1 mL |
792.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ring finger protein 138 Polyclonal antibody specifically detects Ring finger protein 138 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Ring finger protein 138 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 51444 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title