missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNase H1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
280.00 € - 605.00 €
Specifications
| Antigen | RNase H1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Proximity Ligation Assay |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), In situ PLA, Proximity Ligation Assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18709173
|
Novus Biologicals
NBP2-38501 |
0.1 mL |
605.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18689045
|
Novus Biologicals
NBP2-38501-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RNase H1 Polyclonal specifically detects RNase H1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Proximity Ligation Assay.Specifications
| RNase H1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), In situ PLA, Proximity Ligation Assay | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.1.26.4, H1RNA, Ribonuclease H type II, ribonuclease H1, RNase H1, RNH1 | |
| RNASEH1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Proximity Ligation Assay | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O60930 | |
| 246243 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title