missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RP9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | RP9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18291232
|
Novus Biologicals
NBP2-58533 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18668357
|
Novus Biologicals
NBP2-58533-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RP9 Polyclonal specifically detects RP9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RP9 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PAP-1Pim-1-associated protein, Pim-1 kinase associated protein, retinitis pigmentosa 9 (autosomal dominant), retinitis pigmentosa 9 protein | |
| RP9 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6100 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title