missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPIP8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80855-25ul
This item is not returnable.
View return policy
Description
RPIP8 Polyclonal specifically detects RPIP8 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| RPIP8 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q59EK9 | |
| RUNDC3A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKL | |
| 25ul | |
| Signal Transduction | |
| 10900 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Rap2-interacting protein 8, RAP2IPRUN domain-containing protein 3A, RPIP-8, RPIP8RaP2 interacting protein 8, RUN domain containing 3A | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human, rat RPIP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction