missing translation for 'onlineSavingsMsg'
Learn More

RPL7A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-13258-25ul

View more versions of this product

Product Code. 18434092

280.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

RPL7A Polyclonal antibody specifically detects RPL7A in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	RPL7A
Classification	Polyclonal
Dilution	Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL
Gene Alias	60S ribosomal protein L7a, PLA-X polypeptide, ribosomal protein L7a, SURF-3, SURF3surfeit 3, Surfeit locus protein 3, thyroid hormone receptor uncoupling protein, TRUP
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE
Quantity	25 μL
Research Discipline	Apoptosis
Gene ID (Entrez)	6130
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunocytochemistry
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

RPL7A Antibody, Novus Biologicals™

Description

Specifications

Produktvorschläge

Dokumentation

Aktionen