missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPP38 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94050-0.02ml
This item is not returnable.
View return policy
Description
RPP38 Polyclonal antibody specifically detects RPP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| RPP38 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| EC 3.1.26.5, ribonuclease P (38kD) (RPP38), ribonuclease P protein subunit p38, ribonuclease P/MRP 38kDa subunit, RNaseP protein p38 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human RPP38 (NP_892117.1). VVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVR | |
| 0.02 mL | |
| Endocrinology | |
| 10557 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction