missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPP38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | RPP38 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18661958
|
Novus Biologicals
NBP2-68691-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18673468
|
Novus Biologicals
NBP2-68691 |
100 μg |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RPP38 Polyclonal antibody specifically detects RPP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RPP38 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 10557 | |
| IgG | |
| Protein A purified |
| Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.1.26.5, ribonuclease P (38kD) (RPP38), ribonuclease P protein subunit p38, ribonuclease P/MRP 38kDa subunit, RNaseP protein p38 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title