missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPS23 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94136-0.02ml
This item is not returnable.
View return policy
Description
RPS23 Polyclonal antibody specifically detects RPS23 in Human samples. It is validated for Western Blot
Specifications
| RPS23 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ35016, homolog of yeast ribosomal protein S28, ribosomal protein S23,40S ribosomal protein S23 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RPS23 (NP_001016.1). PFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRF | |
| 0.02 mL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6228 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction