missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
RUNDC3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31654-25ul
Denne vare kan ikke returneres.
Se returpolitik
Beskrivelse
RUNDC3B Polyclonal specifically detects RUNDC3B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
| RUNDC3B | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q96NL0 | |
| RUNDC3B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEE | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Rap2 binding protein 9, Rap2-binding protein 9, Rap2-interacting protein 9, RPIB9FLJ30671, RPIP-9, RPIP9MGC26655, RUN domain containing 3B, RUN domain-containing protein 3B | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 154661 | |
| Human | |
| IgG |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion