missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RUSC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81004-25ul
This item is not returnable.
View return policy
Description
RUSC1 Polyclonal specifically detects RUSC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| RUSC1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| DKFZp761A1822, Nesca, NESCARUN and SH3 domain-containing protein 1, New molecule containing SH3 at the carboxy-terminus, RUN and SH3 domain containing 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23623 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| RUSC1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:RRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCG | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering