missing translation for 'onlineSavingsMsg'
Learn More
Learn More
S1P4/EDG-6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94544-0.1ml
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
S1P4/EDG-6 Polyclonal antibody specifically detects S1P4/EDG-6 in Human samples. It is validated for Western Blot
Spezifikation
| S1P4/EDG-6 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EDG6S1P receptor Edg-6, Endothelial differentiation G-protein coupled receptor 6, endothelial differentiation, G-protein-coupled receptor 6, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor6,endothelial differentiation, G protein coupled receptor 6, S1P receptor 4, S1P4LPC1, SLP4, sphingosine 1-phosphate receptor 4, Sphingosine 1-phosphate receptor Edg-6, sphingosine-1-phosphate receptor 4 | |
| A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human S1PR4 (NP_003766.1). SAVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDSFRGSRSLSFRMREPLSSISSVRSI | |
| 0.1 mL | |
| Cell Biology, Cellular Markers, GPCR, Signal Transduction | |
| 8698 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur