missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCYL1BP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 550.00 €
Specifications
| Antigen | SCYL1BP1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230583
|
Novus Biologicals
NBP3-35737-20ul |
20 μL |
190.00 €
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228362
|
Novus Biologicals
NBP3-35737-100ul |
100 μL |
550.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCYL1BP1 Polyclonal antibody specifically detects SCYL1BP1 in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| SCYL1BP1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| FLJ11752, golgin, RAB6-interacting, GONTKL-binding protein 1, hNTKL-BP1, MGC51263, MGC70512, N-terminal kinase-like-binding protein 1, NTKL-BP1, NTKLBP1SCY1-like 1-binding protein 1, RAB6-interacting golgin, SCY1-like 1 binding protein 1, SCYL1-BP1, SCYL1BP1SCYL1-binding protein 1 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SCYL1BP1 (NP_001139511.1).,, Sequence:, MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 92344 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title