missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
288.00 € - 768.00 €
Specifications
| Antigen | Septin-12 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18421032
|
Novus Biologicals
NBP1-91640 |
0.1 mL |
768.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18411422
|
Novus Biologicals
NBP1-91640-25ul |
25 μL |
288.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Septin-12 Polyclonal antibody specifically detects Septin-12 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| Septin-12 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS (pH 7.2) and 40% Glycerol | |
| 124404 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ25410, septin 12, septin-12 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IHYENYRVIRLNESHLLPRGPGWVNLAPASPGQLTTPRTFKVCRGAHDDSDDEF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts