missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Serpin B3/SCCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | Serpin B3/SCCA1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18635645
|
Novus Biologicals
NBP2-46829-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18634426
|
Novus Biologicals
NBP2-46829 |
0.1 mL |
593.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Serpin B3/SCCA1 Polyclonal antibody specifically detects Serpin B3/SCCA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Serpin B3/SCCA1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2), 40% Glycerol | |
| HsT1196, Protein T4-A, SCC, SCCA, SCCA1SCCA-1, SCCA-PD, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin B3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| P48594 | |
| 6317 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title