missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERPINB4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | SERPINB4 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18654416
|
Novus Biologicals
NBP2-46762-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618665
|
Novus Biologicals
NBP2-46762 |
0.1 mL |
624.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SERPINB4 Polyclonal antibody specifically detects SERPINB4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SERPINB4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2), 40% Glycerol | |
| Leupin, Peptidase inhibitor 11, PI-11, PI11clade B (ovalbumin), member 4, serpin peptidase inhibitor, clade B (ovalbumin), member 4, squamous cell carcinoma antigen 1, Squamous cell carcinoma antigen 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QEYLDAIKKFYQTSVESTDFANAPEESRKKI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| P48594 | |
| 6318 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title