missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SF3B5 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94370-0.1ml
This item is not returnable.
View return policy
Description
SF3B5 Polyclonal antibody specifically detects SF3B5 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SF3B5 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| MGC3133, Pre-mRNA-splicing factor SF3b 10 kDa subunit, SF3b10, SF3b5, splicing factor 3B subunit 5, splicing factor 3b, subunit 5, 10kDa, Ysf3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SF3B5 (NP_112577.1). MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 83443 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction