missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ SFTPA1/SFTPA2 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579987

Product Code. 15915555

  • 461.00 € / 100µg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat lung tissue, mouse lung tissue. IHC: Mouse Lung tissue, Rat Lung tissue, Human Lung Cancer tissue IHC-F: Mouse Lung tissue, Rat Lung tissue.

Surfactant protein A (SP-A) is synthesized and secreted by lung epithelial cells. It belongs to group III of the family of C-type lectins and members of this group has overall structure consisting of multiple globular 'head' regions linked by triple-helical, collagen-like, strands. This group also includes SP-D and the serum proteins mannan-binding protein, conglutinin and collectin-43, all of which have been shown to bind to the C1q receptor found on a wide variety of cells. Both SP-D and SP-A have been shown to enhance oxygen radical production by alveolar macrophages. The serum concentration is 45 ng/mL in healthy individuals.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

SFTPA1/SFTPA2
Polyclonal
Unconjugated
SFTPA2
35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
Rabbit
Antigen affinity chromatography
RUO
20387, 24773, 653509, 729238
-20°C
Lyophilized
Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5mg BSA and 0.05mg sodium azide
P08427, P35242, Q8IWL1, Q8IWL2
Sftpa1, SFTPA2
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.