missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sigma-1 R/OPRS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 518.00 €
Specifications
| Antigen | Sigma-1 R/OPRS1 |
|---|---|
| Concentration | 0.1mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18493101
|
Novus Biologicals
NBP1-82479-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18258785
|
Novus Biologicals
NBP1-82479 |
0.1 mL |
518.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Sigma-1 R/OPRS1 Polyclonal antibody specifically detects Sigma-1 R/OPRS1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| Sigma-1 R/OPRS1 | |
| Western Blot 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20 | |
| Polyclonal | |
| Rabbit | |
| Human, Rat | |
| Aging-associated gene 8 protein, FLJ25585, hSigmaR1, OPRS1, SIG-1R, sigma 1, Sigma 1-type opioid receptor, sigma non-opioid intracellular receptor 1, sigma1 receptor, sigma1R, sigma1-receptor, SR31747 binding protein 1, SR31747-binding protein, SR-BP, SR-BP1, SRBPMGC3851, type I sigma receptor | |
| SIGMAR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.1mg/mL | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10280 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title