missing translation for 'onlineSavingsMsg'
Learn More

SKOR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand: Novus Biologicals NBP2-14565

Product Code. 18098453

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products »

This item is not returnable. View return policy

Description

SKOR2 Polyclonal specifically detects SKOR2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	SKOR2
Classification	Polyclonal
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias	CORL2, FUSSEL18, SKOR2 SKI family transcriptional corepressor 2
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	652991
Target Species	Human, Mouse
Isotype	IgG

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	SKOR2
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS
Quantity	0.1 mL
Primary or Secondary	Primary
Test Specificity	Specificity of human SKOR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

SKOR2 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions