missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC15A3. Source: E.coli Amino Acid Sequence: QSTYVLQGLHLHIPNIFPANPANISVALRAQGSSYTIPE The SLC15A3 Recombinant Protein Antigen is derived from E. coli. The SLC15A3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 51296 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | SLC15A3 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | FLJ26631, hPTR3, OCTP, Osteoclast transporter, Peptide transporter 3, Peptide/histidine transporter 2, PHT2PTR3, solute carrier family 15 member 3, solute carrier family 15, member 3 |
| Gene Symbol | SLC15A3 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Show More |
For Research Use Only.
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?