missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 572.00 €
Specifications
| Antigen | SLC25A12 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18179818
|
Novus Biologicals
NBP2-38249 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610746
|
Novus Biologicals
NBP2-38249-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC25A12 Polyclonal specifically detects SLC25A12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC25A12 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O75746 | |
| 8604 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12 | |
| SLC25A12 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title