missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A38 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00 € - 470.00 €
Specifications
| Antigen | SLC25A38 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18683421
|
Novus Biologicals
NBP2-93818-0.02ml |
0.02 mL |
188.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607241
|
Novus Biologicals
NBP2-93818-0.1ml |
0.1 mL |
470.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC25A38 Polyclonal antibody specifically detects SLC25A38 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| SLC25A38 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 54977 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| FLJ20551, FLJ22703, solute carrier family 25 member 38, solute carrier family 25, member 38 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC25A38 (NP_060345.2). MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title