missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC28A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38763
This item is not returnable.
View return policy
Description
SLC28A2 Polyclonal specifically detects SLC28A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SLC28A2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| O43868 | |
| SLC28A2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CNT2SPNT, Concentrative nucleoside transporter 2, FLJ21468, HCNT2, HsT17153, MGC138252, Na(+)/nucleoside cotransporter 2, sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Sodium-coupled nucleoside transporter 2, solute carrier family 28 (sodium-coupled nucleoside transporter), member 2, Solute carrier family 28 member 2, SPNT1CNT 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9153 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction