missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC2A13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83245-25ul
This item is not returnable.
View return policy
Description
SLC2A13 Polyclonal specifically detects SLC2A13 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SLC2A13 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin | |
| Q96QE2 | |
| SLC2A13 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDI | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| H(+)-myo-inositol cotransporter, H(+)-myo-inositol symporter, Hmit, HMITproton (H+) myo-inositol symporter, MGC48624, proton myo-inositol cotransporter, solute carrier family 2 (facilitated glucose transporter), member 13 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 114134 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction