missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC30A6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 624.00 €
Specifications
| Antigen | SLC30A6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18209501
|
Novus Biologicals
NBP2-55067 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18686758
|
Novus Biologicals
NBP2-55067-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC30A6 Polyclonal specifically detects SLC30A6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SLC30A6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 55676 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| MGC45055, MST103, MSTP103, solute carrier family 30 (zinc transporter), member 6, Solute carrier family 30 member 6, zinc transporter 6, ZnT-6, ZNT6FLJ31101 | |
| SLC30A6 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title