missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC38A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13336-25ul
This item is not returnable.
View return policy
Description
SLC38A1 Polyclonal antibody specifically detects SLC38A1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC38A1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Amino acid transporter A1, ATA1SNAT1, NAT2N-system amino acid transporter 2, SAT1amino acid transporter system A1, sodium-coupled neutral amino acid transporter 1, Solute carrier family 38 member 1, solute carrier family 38, member 1, System A amino acid transporter 1, System N amino acid transporter 1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT | |
| 25 μL | |
| ABC Transporters, Cellular Signaling, Neuroscience | |
| 81539 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction