missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC45A3/Prostein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | SLC45A3/Prostein |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18451381
|
Novus Biologicals
NBP1-89629-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18245927
|
Novus Biologicals
NBP1-89629 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
SLC45A3/Prostein Polyclonal specifically detects SLC45A3/Prostein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spezifikation
| SLC45A3/Prostein | |
| Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| IPCA-2, IPCA-6, IPCA-8, PCANAP6IPCA6, PCANAP8, prostate cancer associated protein 2, prostate cancer associated protein 6, prostate cancer associated protein 8, prostate cancer-associated gene 2, prostate cancer-associated gene 6, prostate cancer-associated gene 8, Prostate cancer-associated protein 6, Prostein, PRSTPCANAP2, solute carrier family 45 member 3, solute carrier family 45, member 3 | |
| SLC45A3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.2mg/mL | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 85414 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts