missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC7A5/LAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 559.00 €
Specifications
| Antigen | SLC7A5/LAT1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18493152
|
Novus Biologicals
NBP2-33662-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18766923
|
Novus Biologicals
NBP2-33662 |
0.1 mL |
559.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC7A5/LAT1 Polyclonal specifically detects SLC7A5/LAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC7A5/LAT1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q01650 | |
| 8140 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 4F2 LC, CD98, CD98LC, D16S469EL-type amino acid transporter 1, E16, Integral membrane protein E16, large neutral amino acids transporter 1, large neutral amino acids transporter small subunit 1, LAT1hLAT1, MPE16CD98 light chain, sodium-independent neutral amino acid transporter LAT1,4F2LC, solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain, Solute carrier family 7 member 5, y+ system cationic amino acid transporter | |
| SLC7A5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title