missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC8A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93474-0.02ml
This item is not returnable.
View return policy
Description
SLC8A2 Polyclonal antibody specifically detects SLC8A2 in Human samples. It is validated for Western Blot
Specifications
| SLC8A2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| KIAA1087, Na(+)/Ca(2+)-exchange protein 2, Na+/Ca2+-exchanging protein Nac2, NCX2, sodium/calcium exchanger 2, sodium-calcium exchanger 2, solute carrier family 8 (sodium/calcium exchanger), member 2, solute carrier family 8 (sodium-calcium exchanger), member 2, solute carrier family 8 member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human SLC8A2 (NP_055878.1). LMTGAGNVLRRHAADASRRAAPAEGAGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQGGEGNSTFYVDYRTEDGSAKAGSDYEYSEGT | |
| 0.02 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6543 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction