missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMIM29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
386.00 € - 500.00 €
Specifications
| Antigen | C6orf1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18419640
|
Novus Biologicals
NBP1-81323-25ul |
25ul |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18227545
|
Novus Biologicals
NBP1-81323 |
0.1 mL |
500.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SMIM29 Polyclonal specifically detects SMIM29 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C6orf1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| chromosome 6 open reading frame 1, hypothetical protein LOC221491, LBH, LBHMGC57858, Protein LBH | |
| C6ORF1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 221491 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LRNCMRLSRSCSLTWETPRWYMAGRVATSTSGCHCWMSRRDLTPLPHPSEPGVLDCLGPCHLLPLLSP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel