missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNAP25 Interacting Protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-39005
This item is not returnable.
View return policy
Description
SNAP25 Interacting Protein Polyclonal specifically detects SNAP25 Interacting Protein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| SNAP25 Interacting Protein | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9C0H9 | |
| SRCIN1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGVWPPPNNLLSQSPKKVTAETDFNKSVDFEMPPPSPPLNLHELSGPAEGASLTPKGGNPTKGLDTPGKRSVDKAVSVEAAERDWE | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| KIAA1684P140, p130Cas-associated protein, p140CapSNAP25-interacting protein, SNIPSNAP-25-interacting protein, SRC kinase signaling inhibitor 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 80725 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur