missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SOX13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00 € - 624.00 €
Specifications
| Antigen | SOX13 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18291943
|
Novus Biologicals
NBP2-54996 |
100 μL |
624.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643907
|
Novus Biologicals
NBP2-54996-25ul |
25 μL |
415.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SOX13 Polyclonal specifically detects SOX13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SOX13 | |
| Polyclonal | |
| Rabbit | |
| Diabetes Research, Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9580 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12 | |
| SOX13 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title