missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPACA9 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-94689-0.1ml
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
SPACA9 Polyclonal antibody specifically detects SPACA9 in Human, Mouse, Rat samples. It is validated for Western Blot
Especificaciones
| SPACA9 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| C20orf117, chromosome 20 open reading frame 117, dJ132F21.1, FLJ44670, hypothetical protein LOC140710, KIAA0889, SOGA, suppressor of glucose, autophagy associated 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 650-750 of human SOGA1 (NP_542194.2). AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP | |
| 0.1 mL | |
| Cell Biology | |
| 140710 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido