missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 529.00 €
Specifications
| Antigen | C7orf72 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18434471
|
Novus Biologicals
NBP1-94145-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18054187
|
Novus Biologicals
NBP1-94145 |
0.1 mL |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
SPATA48 Polyclonal specifically detects SPATA48 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| C7orf72 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 100130988 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ANIPGYTGKVHFTATHPANSNIPSTTPSPDSELHRVFQKEMAVDLFRHQAPLSRLVTTVRPYNPFNKKDKETIDY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| chromosome 7 open reading frame 72 | |
| C7orf72 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel