missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPPL2a Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93234-0.02ml
This item is not returnable.
View return policy
Description
SPPL2a Polyclonal antibody specifically detects SPPL2a in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SPPL2a | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| EC 3.4.23, EC 3.4.23.-, IMP-3, IMP3intramembrane cleaving protease, Intramembrane protease 3, Presenilin-like protein 2, PSL2, signal peptide peptidase-like 2A, SPPL2a, SPP-like 2A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human SPPL2A (NP_116191.2). AYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ | |
| 0.02 mL | |
| Cell Biology | |
| 84888 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction