missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRD5A2 Antibody (1F4), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00006716-M01
This item is not returnable.
View return policy
Description
SRD5A2 Monoclonal antibody specifically detects SRD5A2 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| SRD5A2 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 1F4 | |
| Western Blot, ELISA, Sandwich ELISA | |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2, EC 1.3.99.5, MGC138457, S5AR 2, SR type 2, Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2), Type II 5-alpha reductase | |
| SRD5A2 (NP_000339.2, 28 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA | |
| 0.1 mg | |
| Cancer | |
| 6716 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction