missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SSX5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00 €
Specifications
| Antigen | SSX5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SSX5 Polyclonal specifically detects SSX5 in Human samples. It is validated for Western Blot, Tissue Culture Substratum.Specifications
| SSX5 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5 | |
| SSX5 | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_783729 | |
| 6758 | |
| The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title