missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STK38L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-92454
This item is not returnable.
View return policy
Description
STK38L Polyclonal specifically detects STK38L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| STK38L | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 2.7.11, EC 2.7.11.1, KIAA0965nuclear Dbf2-related 2, NDR2 protein kinase, NDR2serine/threonine-protein kinase 38-like, Nuclear Dbf2-related kinase 2, serine/threonine kinase 38 like | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| STK38L | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL | |
| 0.1 mL | |
| Protein Kinase | |
| 23012 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction