missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
386.00 € - 529.00 €
Specifications
| Antigen | STK4 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18478920
|
Novus Biologicals
NBP1-82865-25ul |
25 μL |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18720734
|
Novus Biologicals
NBP1-82865 |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
STK4 Polyclonal specifically detects STK4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| STK4 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.7.11, EC 2.7.11.1, kinase responsive to stress 2, KRS2KRS2)), Mammalian STE20-like protein kinase 1, mammalian sterile 20-like 1, MST-1, MST1DKFZp686A2068, serine/threonine kinase 4, serine/threonine-protein kinase 4, Serine/threonine-protein kinase Krs-2, STE20-like kinase MST1 | |
| STK4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6789 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title