missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
STK4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
386.00 € - 529.00 €
Tekniske data
| Antigen | STK4 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|
18478920
|
Novus Biologicals
NBP1-82865-25ul |
25 μL |
386.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18720734
|
Novus Biologicals
NBP1-82865 |
529.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beskrivelse
STK4 Polyclonal specifically detects STK4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Tekniske data
| STK4 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| EC 2.7.11, EC 2.7.11.1, kinase responsive to stress 2, KRS2KRS2)), Mammalian STE20-like protein kinase 1, mammalian sterile 20-like 1, MST-1, MST1DKFZp686A2068, serine/threonine kinase 4, serine/threonine-protein kinase 4, Serine/threonine-protein kinase Krs-2, STE20-like kinase MST1 | |
| STK4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6789 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel