missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUCLG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00 € - 572.00 €
Specifications
| Antigen | SUCLG1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18679215
|
Novus Biologicals
NBP2-38318-25ul |
25 μL |
280.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18170158
|
Novus Biologicals
NBP2-38318 |
0.1 mL |
572.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUCLG1 Polyclonal specifically detects SUCLG1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SUCLG1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 6.2.1, EC 6.2.1.4, FLJ21114, FLJ43513, GALPHA, MTDPS9, SCS-alpha, succinate-CoA ligase, alpha subunit, succinate-CoA ligase, GDP-forming, alpha subunit, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, Succinyl-CoA synthetase subunit alpha, SUCLA1 | |
| SUCLG1 | |
| IgG | |
| Affinity Purified |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P53597 | |
| 8802 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title