missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUMO4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00 € - 470.00 €
Specifications
| Antigen | SUMO4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18694261
|
Novus Biologicals
NBP2-93213-0.02ml |
0.02 mL |
190.00 €
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18663580
|
Novus Biologicals
NBP2-93213-0.1ml |
0.1 mL |
470.00 €
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUMO4 Polyclonal antibody specifically detects SUMO4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| SUMO4 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Protein Phosphatase | |
| PBS (pH 7.3), 50% glycerol | |
| 387082 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| dJ281H8.4, IDDM5, small ubiquitin-like modifier 4 protein, Small ubiquitin-like protein 4, small ubiquitin-related modifier 4, SMT3 suppressor of mif two 3 homolog 2, SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae), SMT3 suppressor of mif two 3 homolog 4 (yeast), SMT3H4, SUMO-4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (NP_001002255.1). MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title