missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Surfactant Protein A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46679-25ul
This item is not returnable.
View return policy
Description
Surfactant Protein A Polyclonal antibody specifically detects Surfactant Protein A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Surfactant Protein A | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8IWL1 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 653509 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| COLEC4, PSAP, PSPA, PSP-A, SFTP1, SFTPA1B, SPA, SP-A, SPA1, SP-A1, surfactant protein A1B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARA | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction