missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SUV3L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00 € - 539.00 €
Specifications
| Antigen | SUV3L1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18446390
|
Novus Biologicals
NBP1-80711 |
0.1 mL |
539.00 €
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18426200
|
Novus Biologicals
NBP1-80711-25ul |
25 μL |
433.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SUV3L1 Polyclonal antibody specifically detects SUV3L1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SUV3L1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Q8IYB8 | |
| 6832 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| ATP-dependent RNA helicase SUPV3L1, mitochondrial, EC 3.6.1, EC 3.6.4.13, suppressor of var1 (S.cerevisiae) 3-like 1, Suppressor of var1 3-like protein 1, suppressor of var1, 3-like 1 (S. cerevisiae), SUV3-like protein 1, SUV3suppressor of var1, 3-like 1(SUV3) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title