missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
329.00 € - 564.00 €
Specifications
| Antigen | TAK1 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18621514
|
Novus Biologicals
NBP3-21385-25ul |
25 μg |
329.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18684275
|
Novus Biologicals
NBP3-21385-100ul |
100 μg |
564.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TAK1 Polyclonal antibody specifically detects TAK1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| TAK1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Immunology, Innate Immunity, Phospho Specific, Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
| PBS, pH 7.2, 40% glycerol | |
| 6885 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.7.11, EC 2.7.11.25, MEKK7, mitogen-activated protein kinase kinase kinase 7, TAK1/MAP3K7, TAK1TGF1a, TGF-beta activated kinase 1, TGF-beta-activated kinase 1, Transforming growth factor-beta-activated kinase 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title