missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAL2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93861-0.1ml
This item is not returnable.
View return policy
Description
TAL2 Polyclonal antibody specifically detects TAL2 in Rat samples. It is validated for Western Blot
Specifications
| TAL2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| bHLHa19, Class A basic helix-loop-helix protein 19, TAL-2, T-cell acute lymphocytic leukemia 2, T-cell acute lymphocytic leukemia protein 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human TAL2 (NP_005412.1). SAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP | |
| 0.1 mL | |
| Cancer | |
| 6887 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction