missing translation for 'onlineSavingsMsg'
Learn More

TBC1D22B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP1-86751-25ul

View more versions of this product

Product Code. 18405051

292.00 € / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

TBC1D22B Polyclonal specifically detects TBC1D22B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifikationer

Antigen	TBC1D22B
Classification	Polyclonal
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	C6orf197, chromosome 6 open reading frame 197, dJ744I24.2, DKFZp762J0110, FLJ20337, MGC125626, MGC125627, RP4-744I24.2, TBC1 domain family member 22B, TBC1 domain family, member 22B
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	TBC1D22B
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:QHPPLDPRLTKNFIKERSKVNTVPLKNKKASSFHEFARNTSDAWDIGDDEEEDFSSPSFQTLNSK
Quantity	25 μL
Research Discipline	Signal Transduction
Gene ID (Entrez)	55633
Target Species	Human
Isotype	IgG

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

TBC1D22B Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer