missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TC-1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93727-0.02ml
This item is not returnable.
View return policy
Description
TC-1 Polyclonal antibody specifically detects TC-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| TC-1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| chromosome 8 open reading frame 4, hTC-1, MGC22806, TC1 thyroid cancer-1, TC-1human thyroid cancer 1, Thyroid cancer protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human C8orf4 (NP_064515.1). MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH | |
| 0.02 mL | |
| Apoptosis, Cancer, Cell Biology, Signal Transduction, Stem Cells | |
| 56892 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction