missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCEB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00 € - 593.00 €
Specifications
| Antigen | TCEB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18254503
|
Novus Biologicals
NBP2-58862 |
100 μL |
593.00 €
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18661738
|
Novus Biologicals
NBP2-58862-25ul |
25 μL |
369.00 €
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCEB1 Polyclonal specifically detects TCEB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TCEB1 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| eloC, Elongin 15 kDa subunit, elongin-C, RNA polymerase II transcription factor SIII subunit C, SIII, SIII p15, transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C), transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C), transcription elongation factor B polypeptide 1, transcription elongation factor B, polypeptide 1 | |
| ELOC | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6921 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title