missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP1 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88148
This item is not returnable.
View return policy
Description
TCP1 alpha Polyclonal specifically detects TCP1 alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TCP1 alpha | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| CCT1T-complex protein 1 subunit alpha, CCTa, CCT-alpha, D6S230E, tailless complex polypeptide 1, t-complex 1, T-complex protein 1, alpha subunit, TCP-1-alpha | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human TCP1 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TCP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERK | |
| 0.1 mL | |
| Cancer, Hypoxia, Membrane Trafficking and Chaperones, Stem Cell Markers | |
| 6950 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction